PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G21900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NAC
Protein Properties Length: 335aa    MW: 35856.5 Da    PI: 6.3483
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G21900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.3e-5551321128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++
  LPERR03G21900.1   5 LPPGFRFHPTDEELVTYYLTRKVSDFGFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGKDKEIFQ 97 
                      79*************************999.89***************999999**************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +g+lvg+kktLvfy+grapkg kt+Wvmheyrl
  LPERR03G21900.1  98 SgSGALVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 132
                      977888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-643153IPR003441NAC domain
PROSITE profilePS5100561.3135153IPR003441NAC domain
PfamPF023651.2E-296132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF GFATRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TESGYWKTTG KDKEIFQSGS GALVGMKKTL VFYRGRAPKG  120
GKTSWVMHEY RLQSKFPYKP SKDEWVVCRV FKKCHPLIKP RPSLHDDEDI EHGMMGSTAS  180
ELMGHDHHDS PSAAAVGELG EIDVSSMLGV GSFASSGSTG GVICHGVGGD GFGAYMSWLQ  240
AAAASQGAAA MLPWPATTQG LLGTVFAANK AALPFGAAGG CSQPGGVSLA NVGGDHALFG  300
GGAALGKVVE MEMECGGGGE QAAQLDMEES SWRAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-57515317165NO APICAL MERISTEM PROTEIN
1ut4_B4e-57515317165NO APICAL MERISTEM PROTEIN
1ut7_A4e-57515317165NO APICAL MERISTEM PROTEIN
1ut7_B4e-57515317165NO APICAL MERISTEM PROTEIN
3swm_A5e-57515320168NAC domain-containing protein 19
3swm_B5e-57515320168NAC domain-containing protein 19
3swm_C5e-57515320168NAC domain-containing protein 19
3swm_D5e-57515320168NAC domain-containing protein 19
3swp_A5e-57515320168NAC domain-containing protein 19
3swp_B5e-57515320168NAC domain-containing protein 19
3swp_C5e-57515320168NAC domain-containing protein 19
3swp_D5e-57515320168NAC domain-containing protein 19
4dul_A4e-57515317165NAC domain-containing protein 19
4dul_B4e-57515317165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626751e-180AK062675.1 Oryza sativa Japonica Group cDNA clone:001-105-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629240.11e-145PREDICTED: NAC domain-containing protein 59
TrEMBLA0A0D9VWH80.0A0A0D9VWH8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013151-PA1e-145(Oryza sativa Indica Group)
STRINGLOC_Os03g42630.11e-145(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.15e-92NAC domain containing protein 58